scieee AI-readable full text Open interactive document viewer

The identification of the replicative helicase loader gene dciA within the Helicobacter pylori genome challenges current replication initiation models for this bacterium

Brézellec, Pierre

Abstract

Manuscript for submission entitled: The identification of the replicative helicase loader gene dciA within the Helicobacter pylori genome challenges current replication initiation models for this bacterium

Full text

The identification of the replicative helicase loader gene dciA within the Helicobacter pylori genome challenges current replication initiation models for this bacterium Pierre Brézellec*1,2 1 Institut Systématique Evolution Biodiversité (ISYEB UMR 7205), Sorbonne Université, MNHN, CNRS, EPHE, UA – Paris, France 2 Université de Versailles Saint Quentin, 45 avenue des Etats Unis – Versailles, France *Corresponding author Correspondence: [email protected] ABSTRACT At the onset of bacterial chromosome replication initiation, replicative helicases are loaded onto DNA, a process requiring helicase loaders. While organisms documented as lacking a helicase loader are rare, the human pathogen Helicobacter pylori is a notable exception. Here, relying mainly on genomic synteny and AlphaFold, I demonstrate that the well-documented helicase loader gene dciA is present in the H. pylori genome and co-localizes with the uvrC gene (excinuclease ABC subunit C), which highlights the limitations of the usual methodology used to identify dciA. I then provide evidence showing that this finding seriously challenges the two main current chromosome replication initiation models in this bacterium. Given that virulent strains of H. pylori pose a significant threat to human health, contributing to various gastric and non-gastric disorders, including certain cancers, I conclude that a deeper understanding of replication initiation in H. pylori could facilitate the development of more effective therapeutic strategies. Keywords: Genomic Synteny, Protein Structure Prediction, AlphaFold, Bioinformatics 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 Introduction In bacteria, at the onset of chromosome replication initiation, replicative helicases are loaded onto the DnaA-oriC nucleoprotein platform with the assistance of helicase loaders, such as DnaC in Escherichia coli (Arias-Palomo et al., 2013) and DnaI in Bacillus subtilis (Velten et al., 2003). These latter are derived from mobile elements and have replaced, in a few bacterial orders, the ancestral and widespread unrelated replicative helicase loader gene dciA (Brézellec et al., 2016). Bacteria lacking both dnaC/dnaI and dciA are uncommon and generally exhibit small genomes or host-associated lifestyles (Brézellec et al., 2016). Nevertheless, Brézellec and collaborators showed that in two bacterial orders, Cellvibrionales and Oceanospirillales, the lambdoid phage genes λO and λP (the latter encoding the λ phage replicative helicase loader) could have substituted for dciA (Brézellec et al., 2017). In the same vein, in Vibrionales, dciA could also have been frequently replaced by two viral genes (Tominaga et al., 2024). To date, however, Helicobacter pylori is the only extensively studied bacterium that appears to lack the ancestral helicase loader gene dciA or phage gene counterparts (Blaine et al., 2023). While it's presumed that Helicobacter pylori has lost the ancestral replicative helicase loader gene dciA, the unique features of its replicative helicase (HpDnaB) point to a different scenario. HpDnaB exhibits profound differences from classical bacterial replicative helicases. First, HpDnaB differs from canonical DnaB by having a large two-helix insertion, termed HPI, in its Cterminal ATPase domain. This insertion spans 34 amino acid residues (residues 400–433) when compared to Escherichia coli DnaB (Stelter et al., 2012). Second, while classical bacterial replicative helicases display a hexameric architecture, HpDnaB forms head-to-head double hexamers, i.e., a dodecameric architecture (Stelter et al., 2012). This leads me to hypothesize that dciA is still present in the H. pylori genome, but that it has co-evolved with HpDnaB, obscuring its typical Pfam domain signature (DUF721/PF0528) upon which its identification relies. Using genomic synteny, HHpred, and AlphaFold, I demonstrate here that dciA is present in the H. pylori genome and that it co-localizes with the uvrC gene (excinuclease ABC subunit C), see Figure. I then discuss the implications of this finding. Materials and methods Strains of Helicobacter pylori A large number of Helicobacter pylori strains have been sequenced and annotated. In this study, I focused on strains 26695 (ATCC 700392) (Tomb et al., 1997) and G27 (Baltrus et al., 2009). Softwares I used the HHpred tool via its web server (https://toolkit.tuebingen.mpg.de/tools/hhpred). HHpred allows protein domain and structure prediction; it utilizes pairwise alignment of Hidden Markov models (HMMs) to perform sensitive protein sequence searching (Gabler et al., 2020). I used AlphaFold's results stored in the UniProt database. AlphaFold is an artificial intelligence (AI) program developed by DeepMind for protein structure prediction (Jumper et al., 2021). 2 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 Results Genomic co-localization of the dciA and uvrC genes is a feature of numerous Campylobacterales To investigate the presence of dciA in the H. pylori genome, I began by examining its genomic context in dciA-hosting Campylobacterales species, the order to which H. pylori belongs. I aimed to leverage the genes frequently located near dciA to identify it in H. pylori. To achieve this, I utilized both the UniProt (UniProt Consortium, 2025) and KEGG (Kanehisa et al., 2024) databases, as detailed below. To manage the substantial number of Campylobacterales proteomes, I concentrated on Campylobacterales 'reference proteomes' from UniProt. These proteomes offer a representative cross-section of taxonomic diversity and encompass model organisms and species of biomedical/biotech interest. UniProt contains 77 Campylobacterales reference proteomes, see Supplemental file 1 (query in 'Proteomes': (taxonomy_id:213849) AND (proteome_type:1), where '213849' is the 'Taxon ID' for Campylobacterales and '1' indicates 'reference proteome'). As shown in (Blain et al., 2022), DciA homologs across different phyla have low conservation in their primary amino acid sequences; consequently, tools such as BLASTP only retrieve very closely related homologs. DciA is therefore typically identified by its Pfam domain signature, DUF721/PF0528. Consequently, I searched the 77 previously identified reference proteomes for DciA-containing proteins using the following UniProt query: (taxonomy_id:213849) AND duf721 AND (keyword:KW-1185), where 'KW-1185' denotes 'reference proteome'. UniProt returned 49 results, corresponding to 46 bacteria, see Supplemental file 2. Of these, 43 contained a single DciA protein, while 3 (Malaciobacter halophilus, Candidatus Campylobacter infans, and Helicobacter apodemus) contained two. When available, UniProt entries include a cross-reference link to KEGG, a database that provides genomic maps of numerous species, allowing one to trace back from a protein to the genomic location of its encoding gene. Of the 49 previously identified DciA proteins, 24 are linked to KEGG, corresponding to 22 bacterial species, see Supplemental file 3. These include Malaciobacter halophilus and Candidatus Campylobacter infans, which, as previously mentioned, harbor two dciA genes. Of these 24 dciA genes, 17 appear to be co-localized with uvrC (encoding the excinuclease ABC subunit C), see Table below. Interestingly, among these 17 dciA genes, two belong to the genus Helicobacter, namely Helicobacter bizzozeronii (strain CIII1) and Helicobacter hepaticus (strain ATCC 51449 / 3B1). In summary, co-localization of dciA and uvrC is a feature of numerous Campylobacterales. Table - Each line represents a dciA gene. The ‘Organism’ column indicates the species to which dciA belongs. The ‘UniProt ID’ column refers to the UniProt ID of the considered dciA gene. The ‘Genomic context’ column indicates the KEGG annotation of the proteins expressed by the two genes located adjacent to dciA on the considered genome, with dciA referred to by its ordered locus name. As can be seen, the uvrC gene (in bold) is the most frequently located gene adjacent to dciA. Note that Malaciobacter halophilus and Candidatus Campylobacter infans host two dciA genes, while Helicobacter enhydrae expresses one DciA protein linked to two different KEGG loci. Organism UniProt ID Genomic context Aliarcobacter butzleri A8ETA9 L-aspartate oxidase / Abu_0923 / DUF45 domain protein Arcobacter nitrofigilis D5V0A6 L-aspartate oxidase / Arnit_2064 / DUF45 domain protein 3 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 Malaciobacter halophilus A0A2N1J241 A0A2N1J4B3 L-aspartate oxidase / AHALO_1724 / Peptidase M48 family (DUF45 domain protein) Transketolase / AHALO_2569 / Radical SAM superfamily Poseidonibacter parvus A0A1P8KND2 L-aspartate oxidase / LPB137_09295 / Hypothetical protein Campylobacter iguaniorum A0A076FH25 GMP synthase (glutamine-hydrolysing) / CIG1485E_1291 / UvrC Candidatus Campylobacter infans A0A7H9CJ49 A0A7H9CKE6 Type III pantothenate kinase / CINF_0210 / Putative lipoprotein BamB GMP synthase (glutamine-hydrolysing) / CINF_0174 / UvrC Campylobacter curvus A7GX63 UvrC / CCV52592_0937 / Na+/H+ antiporter (NhaD family) Campylobacter jejuni Q0P909 UvrC / Cj1247c / GMP synthase (glutamine-hydrolysing) Campylobacter lari B9KFL2 UvrC / Cla_0499 / Na+/H+ antiporter (NhaD family) Helicobacter enhydrae A0A1B1U6Z8 A0A1B1U6Z8 Hypothetical protein / BBW65_05600 / Host-nuclease inhibitor protein Gam Hypothetical protein / BBW65_07095 / Host-nuclease inhibitor protein Gam Helicobacter bizzozeronii F8KQE8 UvrC / HBZC1_16160 / Hypothetical protein Helicobacter hepaticus Q7VK74 L-aspartate oxidase / HH_0018 / UvrC Wolinella succinogenes Q7MR76 L-aspartate oxidase / WS1606 / UvrC Hydrogenimonas sp A0A3G9GU81 UvrC / NNO_0426 / Hypothetical protein Sulfurimonas lithotrophica A0A5P8P2C0 L-aspartate oxidase / FJR48_09115 / UvrC Sulfurimonas marina A0A7M1AWW5 L-aspartate oxidase / FJR03_09370 / UvrC Candidatus Sulfurimonas marisnigri A0A7S7RQV3 UvrC / HUE87_01880 / Hypothetical protein Sulfurimonas aquatica A0A975AYP7 UvrC / GJV85_02535/ L-aspartate oxidase Sulfurimonas autotrophica E0UQ91 Hypothetical protein / Saut_1790 / UvrC Sulfurospirillum deleyianum D1B011 UvrC / Sdel_0592 / L-aspartate oxidase Nitratifractor salsuginis E6X0A3 UvrC / Nitsa_0422 / L-aspartate oxidase Sulfurovum lithotrophicum A0A7U4RQ57 UvrC / YH65_02565 / L-aspartate oxidase In H. pylori, uvrC co-localizes with dciA Among the 77 Campylobacterales species previously identified (see previous section), two correspond to H. pylori: H. pylori strain ATCC 700392 / 26695 and H. pylori strain G27. Both strains appeared to lack DciA (no DUF721 annotated protein). Given that dciA has been shown to co-localize with uvrC in numerous Campylobacterales (see previous section), I examined the genomic context of uvrC in both H. pylori strains. In H. pylori strain ATCC 700392 / 26695 and H. pylori strain G27, uvrC is identified as UVRC_HELPY and UVRC_HELPG, respectively, and is encoded by the genes HP_0821 and HPG27_780, respectively. Using the KEGG link provided by UniProt to trace the protein back to its gene, uvrC appears to be located on the direct strand at positions 873393 to 875177 (https://www.genome.jp/dbget-bin/www_bget?hpy:HP_0821 , ) and 844372 to 846156 (https://www.genome.jp/dbget-bin/www_bget?hpg:HPG27_780), respectively. Adjacent to uvrC on the same strand, I identified the genes HP_0820 (https://www.kegg.jp/entry/T00008:HP_0820) and HPG27_779 (https://www.kegg.jp/entry/T00777:HPG27_779) at positions 872931 to 873392 and 843910 to 844371, respectively, encoding proteins of 153 amino acids with the following primary sequences: MEQNIFSLLIQKKSYKKLETLLKLKKLKVFMPLSLQENLLFIFIKDSKLLFAFKDIWASK EFNQRFAKEISHFLNTQGHAYGFDGLNGLEILGYVPKDALKKSNFYAPIKKQARFFRPSA LGLFHNPIKDARLHECFEKARALIHYQRSFFEE and MEQNIFSLLIQKKSYKKLETLLKLKKLKVFMPLSLQENLLFIFIKDSKLLFAFKDLWASK EFNQRFAKEISHFLNTQGHAYGFDGLNGLEILGYVPKDALKKANFYAPIKKQARFFRPSA LGLFHNPIKDARLHECFEKARALIHYQRSFFEE 4 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 respectively, see part A of the Figure for HP_0820/O25498_HELPY. In UniProt, HP_0820 and HPG27_779 encode the proteins O25498_HELPY and B5Z7I5_HELPG, respectively, which are described as uncharacterized proteins with neither InterPro nor Pfam annotations. These two proteins share 99% sequence identity and differ by two amino acid mismatches. I began by reannotating these proteins using HHpred. Running HHpred (with default parameters) against Pfam-A_37 (the latest Pfam release, June 2024, containing 21979 families), I found that both O25498_HELPY and B5Z7I5_HELPG harbor the Pfam PF05258/DUF721 domain with a probability of 0.986, see Supplemental files 4 and 5, see part B of the Figure for HP_0820/O25498_HELPY. This domain spans residues 2 to 79. According to the HHpred documentation, a probability exceeding 0.95 indicates near-certain homology. Subsequently, I analyzedexamined the AlphaFold-predicted structures of O25498_HELPY (https://www.uniprot.org/uniprotkb/O25498/entry#structure) and B5Z7I5_HELPG (https://www.uniprot.org/uniprotkb/B5Z7I5/entry#structure), as provided (if available) within the UniProt protein entries. Both structures show very high or high confidence for most residues, with the N-terminal alpha-helix and the linker region exhibiting lower confidence. I then compared these AlphaFold structures to the canonical DciA domain structure, which consists of one alphahelice, two beta-sheets, a third alpha-helix, and a final beta-sheet ((Marsin et al., 2021), (Blain et al., 2022)). The AlphaFold predictions for both proteins align well with the canonical DciA domain structure, see part C of the Figure for HP_0820/O25498_HELPYI then observed that these two AlphaFold structures contained the canonical structural DciA domain architecture, which consists of one alpha helix, followed by two beta sheets, a third alpha helix, and a final beta sheet (ChanYao-Chong et al., 2020). I therefore concluded that HP_0820 and HPG27_779 are the dciA genes of H. pylori strains ATCC 700392 / 26695 and G27, respectively. Discussion Despite the apparent absence of dciA from the H. pylori genome (Blaine et al., 2023), the unique characteristics of its replicative helicase (HpDnaB), when compared to other bacterial replicative helicases (Stelter et al., 2012), prompt me to propose that dciA is still present but has co-evolved with HpDnaB, making it difficult to detect. To test this hypothesis, I decided to use 'genomic synteny', which assumes that during evolution, while genomes can change, some gene arrangements are preserved. With the growing availability of proteome and genome data, I narrowed my focus to the 77 Campylobacterales species, the order to which H. pylori belongs, available as 'reference proteomes' in UniProt (UniProt Consortium, 2025). These 77 Campylobacterales proteomes include, in particular, those of two Helicobacter pylori strains: ATCC 700392 / 26695 and G27. Identifying DciA using the standard DciA Pfam domain signature method, I found that 46 of the 77 Campylobacterales proteomes host a DciA protein. To trace back from proteins to their encoding genes, I relied, when available, on cross-referencing links to KEGG (Kanehisa et al., 2024), a database hosting genomic maps of many species. Among the aforementioned 46 species, 22 are stored in KEGG, offering the opportunity to examine the genomic context of dciA. I then observed that, frequently, dciA is found to co-localize with the uvrC gene, i.e., the excinuclease ABC subunit C gene (see Results section ‘Genomic co-localization of the dciA and 5 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 uvrC genes is a feature of numerous Campylobacterales’). Interestingly, this pattern is observed in particular in two close relatives of Helicobacter pylori, namely Helicobacter bizzozeronii (strain CIII-1) and Helicobacter hepaticus (strain ATCC 51449 / 3B1). I then returned to H. pylori to examine the genomic context of its uvrC gene. As previously mentioned, Ttwo Helicobacter pylori strains are stored in UniProt as 'reference proteomes', namely Helicobacter pylori strain ATCC 700392 / 26695 and Helicobacter pylori strain G27. I focus here only on Helicobacter pylori strain ATCC 700392 / 26695, as similar results are obtained for the other strain (see Results section). The ordered locus name of the uvrC gene in H. pylori strain ATCC 700392 / 26695 is HP_0821. Adjacent to HP_0821, I identified a gene, HP_0820, located on the same strand, encoding a 153-amino-acid-long protein stored as O25498_HELPY in UniProt, see part A of the Figure. The UniProt 'Family & Domains' section provides no annotation for O25498_HELPY. This result indicates that the InterProScan tool (Blum et al., 2025) failed to detect any domain in O25498_HELPY when queried against its integrated member database signatures (e.g., Pfam, PROSITE, etc.). I submitted HP_0820 to HHpred (Gabler et al., 2020), which identified the DciAcharacteristic Pfam DUF721 domain I then submitted HP_0820 to HHpred (Gabler et al., 2020), a profile-profile comparison tool for remote homology detection, which identified the DciAcharacteristic Pfam DUF721 domain (probability > 0.95) in HP_0820, see part B of the Figure. This was further supported by AlphaFold's 3D prediction (Jumper et al., 2021) of HP_0820, which revealed the presence of the canonical DciA domain structure, see part C of the Figure. Taken together, my results strongly suggest that the proteins encoded by HP_0820 in H. pylori strain ATCC 700392 / 26695 and HPG27_780 in H. pylori strain G27 are homologous to DciA (see Results section ‘In H. pylori, uvrC co-localizes with dciA’). This finding significantly challenges the two current models of chromosome replication initiation in H. pylori, as explained below. The first model suggests that H. pylori encodes a gene, HP_0897, which putatively functions as a replicative helicase operator/loader (Verma et al., 2016), (Kumar et al., 2019). In UniProt, HP_0897 corresponds to a protein with ID O25557_HELPY. When submitted to HHpred, analysis revealed that HP_0897 harbors the Pfam DUF721 domain, albeit with a reduced probability (0.884) compared to HP_0820. A visual examination of the HP_0897 AlphaFold structure indicates that, similar to HP_0820, it exhibits the canonical DciA domain structure. The presence of this domain likely explains HP_0897's interaction with the replicative helicase DnaB, mirroring the behavior of DciA in several well-studied bacteria (Caulobacter crescentus (Ozaki et al., 2022), Mycobacterium tuberculosis (Mann et al., 2017), Pseudomonas aeruginosa (Brézellec et al., 2016), and Vibrio cholerae (Marsin et al., 2021)). Interestingly, HP_0820 also interacts with DnaB in Helicobacter pylori (Haüser et al., 2014). However, a significant difference exists between HP_0820 and HP_0897: HP_0820, but not HP_0897, is an essential gene (Salama et al., 2004), a key characteristic of DciA (Blaine et al., 2022). Nevertheless, while focusing on the growth of knockouts in rich media is one way to identify essential genes, gene persistence is another approach to assess a gene's essentiality (Fang et al., 2005). I thus investigated the gene persistence of both HP_0820 and HP_0897. KEGG currently stores 61 complete H. pylori genomes (including strains ATCC 700392 / 26695 and G27). Using the KEGG DBsearch function (which performs a BLASTP of a protein query against the database of all genes stored in KEGG), HP_0820 was found to be persistent—meaning it is present in all 61 H. pylori strains examined (see Supplemental file 6)—whereas HP_0897 is not. Specifically, HP_0897 is found in only 45 out of the 61 strains (see Supplemental file 7). In conclusion, HP_0897 is neither essential in H. pylori strain ATCC 700392 / 26695 nor persistent in the set of 61 H. pylori strains examined, 6 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 unlike HP_0820. Consequently, this strongly suggestsTaken together, these results strongly suggest that DciA/HP_0820, rather than HP_0897, assists H. pylori DnaB at the onset of chromosome replication initiation. The second model, originally proposed prior to the discovery of HP_0897 (Blaine et al., 2023), posits that H. pylori DnaB can self-load onto DNA without requiring a 'dedicated' helicase loader, a hypothesis supported by a study demonstrating HpDnaB's ability to bypass DnaC in E. coli and function as an active replicative helicase (Soni et al., 2005). However, experiments carried out in the DciA-containing bacterium Vibrio cholerae El Tor strain E7946 showed that V. cholerae DnaB can load itself onto DNA in vitro, and that V. cholerae DciA stimulates this function, resulting in increased DNA unwinding (Marsin et al., 2021). Therefore, the ability to selfload onto DNA might be a common feature of replicative helicases in DciA-containing organisms. Overall, my work convincingly suggests that dciA is present in the Helicobacter pylori genome and likely functions as a replicative helicase loader, significantly challenging current models of chromosome replication initiation for this organism. Furthermore, it highlights the limitations of the current methodology used to identify DciA. Moreover, as pointed out by Radford et al. (2023), in the development of novel antibiotics, DNA replication remains a largely underexplored area, even though replisomal proteins are clearly attractive therapeutic targets. This potential can only be realized if the proteins involved in chromosome replication are well-characterized. My work suggests that this criterion is now likely met for Helicobacter pylori. Numerous questions remain to be addressed to fully elucidate replication initiation in Campylobacterales. While fruitful in the case of H. pylori, my hypothesis that DciA has coevolved with HpDnaB, leading to the loss of its classical Pfam domain signature, requires further verification across the entire Campylobacterales order. Alternatively, as previously shown, dciA might have been repeatedly replaced by phage helicase loaders. Both possibilities warrant further investigation. Acknowledgements This work is dedicated to the memory of Jean-Luc Férat, who has passed away. I met JeanLuc in 2000 and began working with him a few months later. Our work on the Dam methyltransferase led to the development of methodologies that paved the way for the discovery of dciA several years later. Throughout this period, Jean-Luc's contributions were crucial. I will deeply miss his insightful ideas, intuition, and discussions. Conflict of interest disclosure The author declares that he complies with the PCI rule of having no financial conflicts of interest in relation to the content of the article. Supplementary information availability Supplemental Files 1, 2, 3, 4, and 5, 6 and 7 are available online as a gzip archive at https://doi.org/10.5281/zenodo.15166355 https://doi.org/10.5281/zenodo.17592664 . References Arias-Palomo E., O'Shea V. L. , Hood I. V., Berger J. M. The bacterial DnaC helicase loader is a DnaB ring breaker. Cell. 2013 Apr 11;153(2):438-48. https://doi.org/10.1016/j.cell.2013.03.006 7 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 Baltrus D. A., Amieva M. R., Covacci A., Lowe T. M., Merrell D. S., Ottemann K. M., Stein M., Salama N. R., Guillemin K. The complete genome sequence of Helicobacter pylori strain G27. J Bacteriol. 2009 Jan;191(1):447-8. https://doi.org/10.1128/jb.01416-08 Blaine H. C., Simmons L. A., Stallings C. L. Diverse Mechanisms of Helicase Loading during DNA Replication Initiation in Bacteria. J Bacteriol. 2023 Apr 25;205(4):e0048722. https://doi.org/10.1128/jb.00487-22 Blaine H .C., Burke J. T., Ravi J., Stallings C. L. DciA Helicase Operators Exhibit Diversity across Bacterial Phyla. J Bacteriol. 2022 Jul 26;204(8):e00163-22. https://doi.org/10.1128/jb.0016322 Blum M, Andreeva A, Florentino LC, Chuguransky SR, Grego T, Hobbs E et al. InterPro: the protein sequence classification resource in 2025. Nucleic Acids Research. 2025, doi: 10.1093/nar/gkae1082 Brézellec P., Vallet-Gely I., Possoz C., Quevillon-Cheruel S., Ferat J. L. DciA is an ancestral replicative helicase operator essential for bacterial replication initiation. Nat Commun. 2016 Nov 10:7:13271. https://doi.org/10.1038/ncomms13271 Brézellec P., Petit M.A., Pasek S., Vallet-Gely I., Possoz C., Ferat J. L. Domestication of Lambda Phage Genes into a Putative Third Type of Replicative Helicase Matchmaker. Genome Biol Evol. 2017 Jun 1;9(6):1561-1566. https://doi.org/10.1093/gbe/evx111 Chan-Yao-Chong M., Marsin S., Quevillon-Cheruel S., Durand D., Ha-Duong T. Structural ensemble and biological activity of DciA intrinsically disordered region. J Struct Biol. 2020 Oct 1;212(1):107573. doi: 10.1016/j.jsb.2020.107573. Fang G., Rocha E., Danchin A. How essential are nonessential genes ? Mol Biol Evol. 2005 Nov;22(11):2147-56. doi: 10.1093/molbev/msi211. Gabler F., Nam S. Z. , Till S., Mirdita M., Steinegger M., Söding J., Lupas A. N., Alva V. Protein Sequence Analysis Using the MPI Bioinformatics Toolkit. Curr Protoc Bioinformatics. 2020 Dec;72(1):e108. https://doi.org/10.1002/cpbi.108 Häuser R., et al. A second-generation protein-protein interaction network of Helicobacter pylori. Mol Cell Proteomics. 2014 May;13(5):1318-29. https://doi.org/10.1074/mcp.o113.033571 Jumper J. et al. Highly accurate protein structure prediction with AlphaFold. Nature. 2021 Aug;596(7873):583-589. https://doi.org/10.1038/s41586-021-03819-2 Kanehisa M., Furumichi M., Sato Y., Matsuura Y., Ishiguro-Watanabe M. KEGG: biological systems database as a model of the real world. Nucleic Acids Res. 2024 Oct 17;53(D1):D672–D677. https://doi.org/10.1093/nar/gkae909 Kumar A., Saha A., Verma V. K., Dhar S. K. Helicobacter pylori helicase loader protein Hp0897 shows unique functions of Nand C-terminal regions. Biochem J. 2019 Nov 15;476(21):32613279. https://doi.org/10.1042/bcj20190430 Mann K. M., Huang D. L., Hooppaw A. J., Logsdon M. M., Richardson K., Joon Lee H., Kimmey J. M., Aldridge B. B., Stallings C. L. Rv0004 is a new essential member of the mycobacterial DNA replication machinery. PLoS Genet. 2017 Nov 27;13(11):e1007115. https://doi.org/10.1371/journal.pgen.1007115 Marsin S. et al. Study of the DnaB:DciA interplay reveals insights into the primary mode of loading of the bacterial replicative helicase. Nucleic Acids Res. 2021 Jun 21;49(11):65696586. https://doi.org/10.1093/nar/gkab463 Ozaki S., Wang D., Wakasugi Y., Itani N., Katayama T. The Caulobacter crescentus DciA promotes chromosome replication through topological loading of the DnaB replicative helicase at replication forks. Nucleic Acids Res. 2022 Dec 9;50(22):12896–12912. https://doi.org/10.1093/nar/gkac1146 Radford H. M., Toft C. J., Sorenson A. E., Schaeffer P. M.. Inhibition of Replication Fork Formation and Progression: Targeting the Replication Initiation and Primosomal Proteins. Int J Mol Sci. 2023 May 15;24(10):8802. https://doi.org/10.3390/ijms24108802 8 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 Salama N. R., Shepherd B., Falkow S. Global transposon mutagenesis and essential gene analysis of Helicobacter pylori. J Bacteriol. 2004 Dec;186(23):7926-35. https://doi.org/10.1128/jb.186.23.7926-7935.2004 Soni R. K., Mehra P., Mukhopadhyay G., Dhar S. K. Helicobacter pylori DnaB helicase can bypass Escherichia coli DnaC function in vivo. Biochem J. 2005 Jul 15;389(Pt 2):541-8. https://doi.org/10.1042/bj20050062 Stelter M., Gutsche I., Kapp U., Bazin A., Bajic G., Goret G., Jamin M., Timmins J., Terradot L. Architecture of a dodecameric bacterial replicative helicase. Structure. 2012 Mar 7;20(3):55464. https://doi.org/10.1016/j.str.2012.01.020 Tomb J. F. et al. The complete genome sequence of the gastric pathogen Helicobacter pylori. Nature. 1997 Aug 7;388(6642):539-47. https://doi.org/10.1038/41483 Tominaga K., Ozaki S., Sato S., Katayama T., Nishimura Y., Omae K., Iwasaki W. Frequent nonhomologous replacement of replicative helicase loaders by viruses in Vibrionaceae. Proc Natl Acad Sci U S A. 2024 May 7;121(19):e2317954121. https://doi.org/10.1073/pnas.2317954121 UniProt Consortium. UniProt: the Universal Protein Knowledgebase in 2025. Nucleic Acids Res. 2025 Jan 6;53(D1):D609-D617. https://doi.org/10.1093/nar/gkae1010 Velten M., McGovern S., Marsin S., Ehrlich S. D., Noirot P., Polard P.. A two-protein strategy for the functional loading of a cellular replicative DNA helicase. Mol Cell. 2003 Apr;11(4):1009-20. https://doi.org/10.1016/s1097-2765(03)00130-8 Verma V., Kumar A., Nitharwal R. G., Alam J., Mukhopadhyay A. K., Dasgupta S., Dhar S. K. 'Modulation of the enzymatic activities of replicative helicase (DnaB) by interaction with Hp0897: a possible mechanism for helicase loading in Helicobacter pylori'. Nucleic Acids Res. 2016 Apr 20;44(7):3288-303. https://doi.org/10.1093/nar/gkw148 9 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368